Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003242-M07 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003242-M07, RRID:AB_1137260
- Product name
- HPD monoclonal antibody (M07), clone 2F3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HPD.
- Antigen sequence
YEAPAFMDPLLPKLPKCSLEMIDHIVGNQPDQEMV
SASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIVV
ANYEESIKMPINEPAPGKKKSQIQEYVDYNGGAGV
QHIAL- Isotype
- IgG
- Antibody clone number
- 2F3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HPD monoclonal antibody (M07), clone 2F3. Western Blot analysis of HPD expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged HPD is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol