H00083549-A01

UCK1 antibody from Abnova Corporation
FLJ12255, URK1
No application information provided.

Antibody data

Product number
H00083549-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00083549-A01, RRID:AB_463664
Product name
UCK1 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00083549-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant UCK1.
Antigen sequence
TKKYADVIIPRGVDNMVAINLIVQHIQDILNGDIC
KWHRGGSNGRSYKRTFSEPGDHPGMLTSGKRSHLE
SSSRP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -