HPA050969

UCK1 antibody from Atlas Antibodies
FLJ12255, URK1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA050969
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA050969, RRID:AB_2681294
Product name
Anti-UCK1
Provider product page
Atlas Antibodies - HPA050969
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IQDILNGDICKWHRGGSNGRSYKRTFSEPGDHPGM
LTSGKRSHLESSSRP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -