Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [10]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001406-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001406-M02, RRID:AB_606098
- Product name
- CRX monoclonal antibody (M02), clone 4G11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CRX.
- Antigen sequence
MMAYMNPGPHYSVNALALSGPSVDLMHQAVPYPSA
PRKQRRERTTFTRSQLEELEALFAKTQYPDVYARE
EVALKINLPESRVQVWFKNRRAKCR- Isotype
- IgG
- Antibody clone number
- 4G11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Production of Retinal Cells from Confluent Human iPS Cells.
Characterization and pharmacologic targeting of EZH2, a fetal retinal protein and epigenetic regulator, in human retinoblastoma.
Differentiation of retinal ganglion cells and photoreceptor precursors from mouse induced pluripotent stem cells carrying an Atoh7/Math5 lineage reporter.
Transplantation of photoreceptors derived from human Muller glia restore rod function in the P23H rat.
From confluent human iPS cells to self-forming neural retina and retinal pigmented epithelium.
Mechanistically distinct mouse models for CRX-associated retinopathy.
The expression of retinal cell markers in human retinal pigment epithelial cells and their augmentation by the synthetic retinoid fenretinide.
Distinct effects of Hedgehog signaling on neuronal fate specification and cell cycle progression in the embryonic mouse retina.
BEST1 expression in the retinal pigment epithelium is modulated by OTX family members.
Crx activates opsin transcription by recruiting HAT-containing co-activators and promoting histone acetylation.
Reichman S, Goureau O
Methods in molecular biology (Clifton, N.J.) 2016;1357:339-51
Methods in molecular biology (Clifton, N.J.) 2016;1357:339-51
Characterization and pharmacologic targeting of EZH2, a fetal retinal protein and epigenetic regulator, in human retinoblastoma.
Khan M, Walters LL, Li Q, Thomas DG, Miller JM, Zhang Q, Sciallis AP, Liu Y, Dlouhy BJ, Fort PE, Archer SM, Demirci H, Dou Y, Rao RC
Laboratory investigation; a journal of technical methods and pathology 2015 Nov;95(11):1278-90
Laboratory investigation; a journal of technical methods and pathology 2015 Nov;95(11):1278-90
Differentiation of retinal ganglion cells and photoreceptor precursors from mouse induced pluripotent stem cells carrying an Atoh7/Math5 lineage reporter.
Xie BB, Zhang XM, Hashimoto T, Tien AH, Chen A, Ge J, Yang XJ
PloS one 2014;9(11):e112175
PloS one 2014;9(11):e112175
Transplantation of photoreceptors derived from human Muller glia restore rod function in the P23H rat.
Jayaram H, Jones MF, Eastlake K, Cottrill PB, Becker S, Wiseman J, Khaw PT, Limb GA
Stem cells translational medicine 2014 Mar;3(3):323-33
Stem cells translational medicine 2014 Mar;3(3):323-33
From confluent human iPS cells to self-forming neural retina and retinal pigmented epithelium.
Reichman S, Terray A, Slembrouck A, Nanteau C, Orieux G, Habeler W, Nandrot EF, Sahel JA, Monville C, Goureau O
Proceedings of the National Academy of Sciences of the United States of America 2014 Jun 10;111(23):8518-23
Proceedings of the National Academy of Sciences of the United States of America 2014 Jun 10;111(23):8518-23
Mechanistically distinct mouse models for CRX-associated retinopathy.
Tran NM, Zhang A, Zhang X, Huecker JB, Hennig AK, Chen S
PLoS genetics 2014 Feb;10(2):e1004111
PLoS genetics 2014 Feb;10(2):e1004111
The expression of retinal cell markers in human retinal pigment epithelial cells and their augmentation by the synthetic retinoid fenretinide.
Carr AJ, Vugler AA, Yu L, Semo M, Coffey P, Moss SE, Greenwood J
Molecular vision 2011;17:1701-15
Molecular vision 2011;17:1701-15
Distinct effects of Hedgehog signaling on neuronal fate specification and cell cycle progression in the embryonic mouse retina.
Sakagami K, Gan L, Yang XJ
The Journal of neuroscience : the official journal of the Society for Neuroscience 2009 May 27;29(21):6932-44
The Journal of neuroscience : the official journal of the Society for Neuroscience 2009 May 27;29(21):6932-44
BEST1 expression in the retinal pigment epithelium is modulated by OTX family members.
Esumi N, Kachi S, Hackler L Jr, Masuda T, Yang Z, Campochiaro PA, Zack DJ
Human molecular genetics 2009 Jan 1;18(1):128-41
Human molecular genetics 2009 Jan 1;18(1):128-41
Crx activates opsin transcription by recruiting HAT-containing co-activators and promoting histone acetylation.
Peng GH, Chen S
Human molecular genetics 2007 Oct 15;16(20):2433-52
Human molecular genetics 2007 Oct 15;16(20):2433-52
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CRX monoclonal antibody (M02), clone 4G11 Western Blot analysis of CRX expression in IMR-32 ( Cat # L008V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CRX expression in transfected 293T cell line by CRX monoclonal antibody (M02), clone 4G11.Lane 1: CRX transfected lysate(32 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CRX is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
