Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005162-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005162-M03, RRID:AB_535000
- Product name
- PDHB monoclonal antibody (M03), clone 2B2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PDHB.
- Antigen sequence
LEAAAVLSKEGVECEVINMRTIRPMDMETIEASVM
KTNHLVTVEGGWPQFGVGAEICARIMEGPAFNFLD
APAVRVTGADVPMPYAKILEDNSIPQVKDIIFAIK
KTLNI- Isotype
- IgG
- Antibody clone number
- 2B2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Proteomics of uveal melanomas suggests HSP-27 as a possible surrogate marker of chromosome 3 loss.
Coupland SE, Vorum H, Mandal N, Kalirai H, Honoré B, Urbak SF, Lake SL, Dopierala J, Damato B
Investigative ophthalmology & visual science 2010 Jan;51(1):12-20
Investigative ophthalmology & visual science 2010 Jan;51(1):12-20
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PDHB monoclonal antibody (M03), clone 2B2 Western Blot analysis of PDHB expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of PDHB expression in transfected 293T cell line by PDHB monoclonal antibody (M03), clone 2B2.Lane 1: PDHB transfected lysate(39.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PDHB is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to PDHB on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
