HPA037483

antibody from Atlas Antibodies

Targeting: ZCCHC8 DKFZp434E2220

Antibody data

Submit

Validation data

Product number: HPA037483 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA037483, RRID:AB_10671502
Product name: Anti-ZCCHC8
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PGWLKEAELENSGLALYDGKDGTDGETEVGEIQQN KSVTYDLSKLVNYPGFNISTPRGIPDEWRIFGSIP MQACQQKDVFANYLTSNFQAPGVKSGNK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ZCCHC8 protein structure - HPA037483 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows strong nuclear positivity in purkinje cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube show strong nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows strong nuclear positivity in myocytes.
Sample type: HUMAN