HPA026853

antibody from Atlas Antibodies

Targeting: SMARCC1 BAF155, CRACC1, Rsc8, SRG3

Antibody data

Submit

Validation data

Product number: HPA026853 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA026853, RRID:AB_10603030
Product name: Anti-SMARCC1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: AHVKKVQEAARASGKVDPTYGLESSCIAGTGPDEP EKLEGAEEEKMEADPDGQQPEKAENKVENETDEGD KAQDGENEKNSEKEQDSEVSEDTKSEEKETEENKE LTDTCKERESDTGKKKVEHEISEGNVATAAAAALA SAATKAKHL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SMARCC1 protein structure - HPA026853 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA026853 antibody. Corresponding SMARCC1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human placenta, skeletal muscle, testis and tonsil using Anti-SMARCC1 antibody HPA026853 (A) shows similar protein distribution across tissues to independent antibody HPA024352 (B).
Antibody #2 product nr: HPA024352
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows distinct nuclear positivity in trophoblastic cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows strong nuclear positivity in germinal center cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Sample type: HUMAN