Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90634 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90634, RRID:AB_2665614
- Product name
- Anti-ACSL5
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
VHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSL
KVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGK
EHFRKPVPPSPEDLSVICFTSGTTGDPK- Epitope
- Binds to an epitope located within the peptide sequence MDPFDDDLKQ as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL0275
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: ACSL5 Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414108)
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows strong cytoplasmic and membrane immunoreactivity in the glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong positivity in the intestinal glands.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows moderate cytoplasmic immunoreactivity in hepatocytes.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows very strong cytoplasmic and membrane immunoreactivity in the glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon (colorectal cancer) shows moderate membrane positivity in cancer cells.