Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405104 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Gap Junction Protein, alpha 9, 59kDa (GJA9) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GJA9 antibody: synthetic peptide directed towards the middle region of human GJA9
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSS
TEHEN RGSPPKGNLK- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Dermatofibrosarcoma protuberans, giant cell fibroblastoma, and hybrid lesions in children: clinicopathologic comparative analysis of 28 cases with molecular data--a study from the French Federation of Cancer Centers Sarcoma Group.
Expression profiles of the novel human connexin genes hCx30.2, hCx40.1, and hCx62 differ from their putative mouse orthologues.
Terrier-Lacombe MJ, Guillou L, Maire G, Terrier P, Vince DR, de Saint Aubain Somerhausen N, Collin F, Pedeutour F, Coindre JM
The American journal of surgical pathology 2003 Jan;27(1):27-39
The American journal of surgical pathology 2003 Jan;27(1):27-39
Expression profiles of the novel human connexin genes hCx30.2, hCx40.1, and hCx62 differ from their putative mouse orthologues.
Söhl G, Nielsen PA, Eiberger J, Willecke K
Cell communication & adhesion 2003 Jan-Feb;10(1):27-36
Cell communication & adhesion 2003 Jan-Feb;10(1):27-36
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Host: Rabbit Target Name: GJA9 Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 μg/mL