R32260

SCARB1 antibody from NSJ Bioreagents
CD36L1, CLA-1, CLA1, SR-BI, SRB1

Antibody data

Product number
R32260
Provider
NSJ Bioreagents
Product name
Srb1 Antibody
Provider product page
NSJ Bioreagents - R32260
Antibody type
Polyclonal
Antigen
Amino acids KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL of mouse Srb1 were used as the immunogen for the Srb1 antibody.
Description
Antigen affinity
Reactivity
Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Vial size
100 µg
Concentration
Lyophilized; resuspend with 200 ul for 0.5 mg/ml
Storage
After reconstitution, the Srb1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -