Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006434-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006434-M01, RRID:AB_566177
- Product name
- SFRS10 monoclonal antibody (M01), clone 7A1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SFRS10.
- Antigen sequence
LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQ
SRRSRGFAFVYFENVDDAKEAKERANGMELDGRRI
RVDFSITKRP- Isotype
- IgG
- Antibody clone number
- 7A1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Multiple therapeutic effects of valproic acid in spinal muscular atrophy model mice.
Tsai LK, Tsai MS, Ting CH, Li H
Journal of molecular medicine (Berlin, Germany) 2008 Nov;86(11):1243-54
Journal of molecular medicine (Berlin, Germany) 2008 Nov;86(11):1243-54
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SFRS10 expression in transfected 293T cell line by SFRS10 monoclonal antibody (M01), clone 7A1.Lane 1: SFRS10 transfected lysate(33.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SFRS10 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol