AMAb91041

antibody from Atlas Antibodies

Targeting: SLC17A7 BNPI, VGLUT1

Western blot (Supportive data in Antibodypedia)

Immunohistochemistry (Enhanced validation)

Antibody Data

Product number

AMAb91041

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#AMAb91041, RRID:AB_2665777

Product name

Anti-VGLUT1

Antibody type

Monoclonal

Reactivity

Human, Mouse, Rat

Host

Mouse

Conjugate

Unconjugated

Antigen sequence

PSISEEERKYIEDAIGESAKLMNPLTKFSTP


Epitope

Binds to an epitope located within the peptide sequence EERKYIEDAI as determined by overlapping synthetic peptides.

Isotype

IgG

Antibody clone number

CL2754

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Western blot

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue

Immunohistochemistry

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Orthogonal validation

Main image

Experimental details

Immunohistochemistry analysis in human cerebral cortex and tonsil tissues using AMAb91041 antibody. Corresponding VGLUT1 RNA-seq data are presented for the same tissues.

Sample type

HUMAN

Orthogonal method

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Show more

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of rat cerebellum shows strong immunoreactivity in glutamatergic processes in the molecular and granular cell layers.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of mouse hippocampal formation shows strong positivity in glutamatergic fibers in the CA1 area.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex shows strong immunoreactivity in neuropil.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of rat hippocampal formation shows strong positivity in glutamatergic fibers in the dentate gyrus .

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of mouse cerebellum shows strong immunoreactivity in glutamatergic processes in the molecular and granular cell layers.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebellum shows immunoreactivity in glutamatergic fibers in the granular cell layer.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human tonsil shows absence of immunoreactivity (negative control).

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of rat brain shows strong positivity in glutamatergic processes in the molecular and granular layers of cerebellum.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of rat brain shows strong positivity in glutamatergic fibers in the polymorph layer of dentate gyrus.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse brain shows strong positivity in glutamatergic fibers in the molecular and granular layers of the cerebellum.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse hippocampus shows strong positivity in glutamatergic fibers in the CA2 layer.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex shows strong positivity in neuropil.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected.