HPA031608

antibody from Atlas Antibodies

Targeting: ASCC3 ASC1p200, dJ121G13.4, dJ467N11.1, HELIC1, RNAH

Antibody data

Submit

Validation data

Product number: HPA031608 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA031608, RRID:AB_10599970
Product name: Anti-ASCC3
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GREAIESGAAFLFMTFHLKDSVGHKETKAIKQMFG PFPSSSATAACNATNRIISHFSQDDLTALVQMTEK EHGDRVFFGKNLAFSFDMHDLDHFDELPING
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ASCC3 protein structure - HPA031608 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, lymph node and testis using Anti-ASCC3 antibody HPA031608 (A) shows similar protein distribution across tissues to independent antibody HPA031609 (B).
Antibody #2 product nr: HPA031609, HPA031610
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-ASCC3 antibody HPA031608.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-ASCC3 antibody HPA031608.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-ASCC3 antibody HPA031608.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-ASCC3 antibody HPA031608.
Sample type: HUMAN