Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405544 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-HECT Domain and Ankyrin Repeat Containing, E3 Ubiquitin Protein Ligase 1 (HACE1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HACE1 antibody: synthetic peptide directed towards the middle region of human HACE1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQE
ERVLL LQFVTGSSRV- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The E3 ligase HACE1 is a critical chromosome 6q21 tumor suppressor involved in multiple cancers.
Zhang L, Anglesio MS, O'Sullivan M, Zhang F, Yang G, Sarao R, Mai PN, Cronin S, Hara H, Melnyk N, Li L, Wada T, Liu PP, Farrar J, Arceci RJ, Sorensen PH, Penninger JM
Nature medicine 2007 Sep;13(9):1060-9
Nature medicine 2007 Sep;13(9):1060-9
No comments: Submit comment
No validations: Submit validation data