HPA036630

LIN28B antibody from Atlas Antibodies
CSDD2, FLJ16517

Antibody data

Product number
HPA036630
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA036630, RRID:AB_10669911
Product name
Anti-LIN28B
Provider product page
Atlas Antibodies - HPA036630
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KKCHYCQSIMHMVANCPHKNVAQPPASSQGRQEAE
SQPCTSTLPREVGGGHGCTSPPFPQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.