HPA038451

REXO2 antibody from Atlas Antibodies
CGI-114, DKFZP566E144, SFN
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA038451
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA038451, RRID:AB_10697391
Product name
Anti-REXO2
Provider product page
Atlas Antibodies - HPA038451
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KQPDELLDSMSDWCKEHHGKSGLTKAVKESTITLQ
QAEYEFLSFVRQQTPPGLCPLAGNSVHEDKKFLDK
YMP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -