HPA046615

FBXW5 antibody from Atlas Antibodies
DKFZP434B205, Fbw5, MGC20962
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA046615
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA046615, RRID:AB_10965648
Product name
Anti-FBXW5
Provider product page
Atlas Antibodies - HPA046615
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PDNRYLYVNSRAWPNGAVVADPMQPPPIAEEIDLL
VFDLKTMREVRRALRAHRAYTPNDECFFIFLDVSR
DFVASGAEDRHGYIWDRHYNICLARLRHEDVVNSV
VFSPQEQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -