HPA036671

TRMT10C antibody from Atlas Antibodies
FLJ20432, MRPP1, RG9MTD1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA036671
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA036671, RRID:AB_10602085
Product name
Anti-TRMT10C
Provider product page
Atlas Antibodies - HPA036671
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SVSVNFFRPFTRFLVPFTLHRKRNNLTILQRYMSS
KIPAVTYPKNESTPPSEELELDKWKTTMKSSVQEE
CVSTISSSKDEDPLAATR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -