Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29484 - Provider product page
- Provider
- Abnova Corporation
- Product name
- COPB1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- COPB1 polyclonal antibody raised against recombinant human COPB1.
- Antigen sequence
NKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALS
GYCGFMAANLYARSIFGEDALANVSIEKPIHQGPD
AAVTGHIRIRAKSQGMALSLGDKINLSQKKT- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot (Cell lysate) analysis of RT-4 cell lysate with COPB1 polyclonal antibody (Cat# PAB29484) at 1:100 - 1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of RH-30 cells with COPB1 polyclonal antibody (Cat# PAB29484) under 1-4 ug/mL working concentration shows positivity in cytoplasm and the Golgi apparatus. Antibody staining is shown in green.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with COPB1 polyclonal antibody (Cat# PAB29484) shows cytoplasmic positivity in cells in seminiferus ducts at 1:20 - 1:50 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)