SAB2102143

SIDT2 antibody from Sigma-Aldrich
CGI-40
No application information provided.

Antibody data

Product number
SAB2102143
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2102143, RRID:AB_10605757
Product name
Anti-SIDT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2102143
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_001035545.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LNKQKGAPLLFVVRQKEAVVSFQVPLILRGMFQRK
YLYQKVERTLCQPPT
Storage
-20C
Provider Type Product Number
- No reagents -