Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [3]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008805-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008805-M01, RRID:AB_464118
- Product name
- TRIM24 monoclonal antibody (M01), clone 2F2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TRIM24.
- Antigen sequence
PQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLA
QLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQGP
IQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQ
QLRYPPNQNIPRQAIKPNPLQMAFLAQQAIKQW- Isotype
- IgG
- Antibody clone number
- 2F2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Overexpression of TRIM24 is associated with the onset and progress of human hepatocellular carcinoma.
TRIM24 mediates ligand-dependent activation of androgen receptor and is repressed by a bromodomain-containing protein, BRD7, in prostate cancer cells.
Liu X, Huang Y, Yang D, Li X, Liang J, Lin L, Zhang M, Zhong K, Liang B, Li J
PloS one 2014;9(1):e85462
PloS one 2014;9(1):e85462
TRIM24 mediates ligand-dependent activation of androgen receptor and is repressed by a bromodomain-containing protein, BRD7, in prostate cancer cells.
Kikuchi M, Okumura F, Tsukiyama T, Watanabe M, Miyajima N, Tanaka J, Imamura M, Hatakeyama S
Biochimica et biophysica acta 2009 Dec;1793(12):1828-36
Biochimica et biophysica acta 2009 Dec;1793(12):1828-36
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TRIM24 monoclonal antibody (M01), clone 2F2 Western Blot analysis of TRIM24 expression in IMR-32 ( Cat # L008V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TRIM24 monoclonal antibody (M01), clone 2F2. Western Blot analysis of TRIM24 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of TRIM24 expression in transfected 293T cell line by TRIM24 monoclonal antibody (M01), clone 2F2.Lane 1: TRIM24 transfected lysate(116.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to TRIM24 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of TRIM24 transfected lysate using anti-TRIM24 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TRIM24 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to TRIM24 on formalin-fixed paraffin-embedded human testis. [antibody concentration 6 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
