Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005013-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005013-A01, RRID:AB_462546
- Product name
- OTX1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant OTX1.
- Antigen sequence
YGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTT
FTRSQLDVLEALFAKTRYPDIFMREEVALKINLPE
SRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSP
VR- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Murine embryonic stem cell-derived pyramidal neurons integrate into the cerebral cortex and appropriately project axons to subcortical targets.
Expression of the homeobox genes PAX6, OTX2, and OTX1 in the early human fetal retina.
Ideguchi M, Palmer TD, Recht LD, Weimann JM
The Journal of neuroscience : the official journal of the Society for Neuroscience 2010 Jan 20;30(3):894-904
The Journal of neuroscience : the official journal of the Society for Neuroscience 2010 Jan 20;30(3):894-904
Expression of the homeobox genes PAX6, OTX2, and OTX1 in the early human fetal retina.
Larsen KB, Lutterodt M, Rath MF, Møller M
International journal of developmental neuroscience : the official journal of the International Society for Developmental Neuroscience 2009 Aug;27(5):485-92
International journal of developmental neuroscience : the official journal of the International Society for Developmental Neuroscience 2009 Aug;27(5):485-92
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- OTX1 polyclonal antibody (A01), Lot # MAI0060316QCS1. Western Blot analysis of OTX1 expression in Raw 264.7.