Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005653-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005653-M01, RRID:AB_714756
- Product name
- KLK6 monoclonal antibody (M01), clone 4A10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant KLK6.
- Antigen sequence
RAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPL
PLERDCSANTTSCHILGWGKTADGDFPDTIQCAYI
HLVSREECEHAYPGQITQNMLCAGDEKYGK- Isotype
- IgG
- Antibody clone number
- 4A10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Correlation between KLK6 expression and the clinicopathological features of glioma.
Lou J, Si H, Chen Y, Sun X, Zhang H, Niu A, Hu C
Contemporary oncology (Poznan, Poland) 2014;18(4):246-51
Contemporary oncology (Poznan, Poland) 2014;18(4):246-51
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of KLK6 expression in transfected 293T cell line by KLK6 monoclonal antibody (M01), clone 4A10.Lane 1: KLK6 transfected lysate(26.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged KLK6 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol