Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB22052 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB22052, RRID:AB_10965345
- Product name
- WEE2 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant WEE2.
- Antigen sequence
TKSGNHFEEPKLKDILLQISLGLNYIHNSSMVHLD
IKPSNIFICHKMQSESSGVIEEVENEADWFLSANV
MYKIGDLGHATSINKPKVEEGD- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 with WEE2 polyclonal antibody (Cat # PAB22052) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli and cytoplasm.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum with WEE2 polyclonal antibody (Cat # PAB22052) shows strong positivity in gobblet cells at 1:500-1:1000 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)