AV54594

ARCN1 antibody from MilliporeSigma / Merck KGaA
COPD
No application information provided.

Antibody data

Product number
AV54594
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV54594, RRID:AB_1844973
Product name
Anti-ARCN1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV54594
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ARCN1 with an internal ID of P31378
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDK
KGVQLQTHPNVDKKL
Storage
-20C
Provider Type Product Number
- No reagents -