Explore
Validate
LearnPAB22526
antibody from Abnova Corporation
Targeting: RSPH4A
CILD11, dJ412I7.1, FLJ37974, RSHL3, RSPH6B
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB22526 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB22526, RRID:AB_10967550
- Product name
- RSHL3 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant RSHL3.
- Antigen sequence
RPWEGKTAASPQYSEPESSEPLEAKQGPETGRQSR
SSRPWSPQSRAKTPLGGPAGPETSSPAPVSPREPS
SSP- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with RSHL3 polyclonal antibody (Cat # PAB22526) at 1:250-1:500 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 with RSHL3 polyclonal antibody (Cat # PAB22526) at 1-4 ug/mL dilution shows positivity in nucleus.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human bronchus with RSHL3 polyclonal antibody (Cat # PAB22526) shows strong cytoplasmic and membranous positivity in respiratory epithelial cells at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
