HPA029245

USF3 antibody from Atlas Antibodies
KIAA2018
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA029245
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA029245, RRID:AB_10600443
Product name
Anti-USF3
Provider product page
Atlas Antibodies - HPA029245
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LKANDICLYDDPTIHWKGNLKNSKVSVVIPSDQVQ
KKIIVYSNGNQPGGNSQGTAVQGITFNVSHNLQKQ
TANVVPVQRTCNLVTPV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -