Antibody data

Product number
PAB22263
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22263, RRID:AB_10967135
Product name
KIAA2018 polyclonal antibody
Provider product page
Abnova Corporation - PAB22263
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant KIAA2018.
Antigen sequence
LKANDICLYDDPTIHWKGNLKNSKVSVVIPSDQVQ
KKIIVYSNGNQPGGNSQGTAVQGITFNVSHNLQKQ
TANVVPVQRTCNLVTPV
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -