HPA029243

USF3 antibody from Sigma-Aldrich
KIAA2018
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029243
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA029243, RRID:AB_10611114
Product name
Anti-KIAA2018 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA029243
Antibody type
Polyclonal
Antigen
KIAA2018 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTSRGLEQQMVSQPSIVTRSSDMTCTPHRPERNRV
SSYSAEALIGKTSSNSEQRMGISIQGSRVSDQLEM
RSYLDVPRNK
Storage
-20C
Provider Type Product Number
- No reagents -