H00000523-A01

antibody from Abnova Corporation

Targeting: ATP6V1A ATP6A1, ATP6V1A1, VA68, Vma1, VPP2

Western blot (Supportive data in Antibodypedia)

Antibody Data

Product number

H00000523-A01

Provider

Abnova Corporation

Proper citation

Abnova Corporation Cat#H00000523-A01, RRID:AB_605964

Product name

ATP6V1A polyclonal antibody (A01)

Antibody type

Polyclonal

Description

Mouse polyclonal antibody raised against a partial recombinant ATP6V1A.

Antigen sequence

TLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLS
NMIAFYDMARRAVETTAQSDNKITWSIIREHMGDI
LYKLSSMKFKDPLKDGEAKIKSDYAQLLEDMQNAF
RSLED


Storage

Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

References

Submitted references

Regulated assembly of vacuolar ATPase is increased during cluster disruption-induced maturation of dendritic cells through a phosphatidylinositol 3-kinase/mTOR-dependent pathway.

Liberman R, Bond S, Shainheit MG, Stadecker MJ, Forgac M
The Journal of biological chemistry 2014 Jan 17;289(3):1355-63

---

A cytotoxic type III secretion effector of Vibrio parahaemolyticus targets vacuolar H+-ATPase subunit c and ruptures host cell lysosomes.

Matsuda S, Okada N, Kodama T, Honda T, Iida T
PLoS pathogens 2012;8(7):e1002803

---

Inhibition of activated Stat3 reverses drug resistance to chemotherapeutic agents in gastric cancer cells.

Huang S, Chen M, Shen Y, Shen W, Guo H, Gao Q, Zou X
Cancer letters 2012 Feb 28;315(2):198-205

---

Effects and mechanisms of proton pump inhibitors as a novel chemosensitizer on human gastric adenocarcinoma (SGC7901) cells.

Chen M, Zou X, Luo H, Cao J, Zhang X, Zhang B, Liu W
Cell biology international 2009 Sep;33(9):1008-19

Western blot

Supportive validation

Submitted by

Abnova Corporation (provider)

Main image

Experimental details

ATP6V1A polyclonal antibody (A01), Lot # 060717JCS1. Western Blot analysis of ATP6V1A expression in Daoy.