HPA058546

GPX4 antibody from Atlas Antibodies
MCSP, PHGPx

Antibody data

Product number
HPA058546
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA058546, RRID:AB_2683749
Product name
Anti-GPX4
Provider product page
Atlas Antibodies - HPA058546
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRG
FVCIVTNVAS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -