Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1449862 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 80 (ZNF80) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- A synthetic peptide directed towards the N-terminal region of human ZNF80
- Description
- Peptide immunoaffinity column
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MSPKRDGLGTGDGLHSQVLQEQVSTGDNLHECDSQ
GPSKDTLVREGKTYK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1.0 mg/mL after reconstitution
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or (in aliquots) at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Characterization and genomic mapping of the ZNF80 locus: expression of this zinc-finger gene is driven by a solitary LTR of ERV9 endogenous retroviral family.
Di Cristofano A, Strazzullo M, Longo L, La Mantia G
Nucleic acids research 1995 Aug 11;23(15):2823-30
Nucleic acids research 1995 Aug 11;23(15):2823-30
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human HT1080; WB Suggested Anti-ZNF80 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: HT1080 cell lysate; ZNF80 antibody - N-terminal region (AP44233PU-N) in Human HT1080 cells using Western Blot
