HPA074851

HEY2 antibody from Atlas Antibodies
bHLHb32, HERP1, HESR2

Antibody data

Product number
HPA074851
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA074851, RRID:AB_2686718
Product name
Anti-HEY2
Provider product page
Atlas Antibodies - HPA074851
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PCEETTSESDMDETIDVGSENNYSGQSTSSVIRLN
SPTTTSQIMARKK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -