PAB22642

TFPT antibody from Abnova Corporation
amida, FB1, INO80F

Antibody data

Product number
PAB22642
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22642, RRID:AB_10983325
Product name
TFPT polyclonal antibody
Provider product page
Abnova Corporation - PAB22642
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant TFPT.
Antigen sequence
RLHQVQRITRRLQQERRFLMRVLDSYGDDYRASQF
TIVLEDEGSQGTDAPTPGNAENEPPEKETLS
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -