Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AV36687 - Provider product page
- Provider
- MilliporeSigma / Merck KGaA
- Product name
- Anti-ANXA5 (AB2) antibody produced in rabbit
- Antibody type
- Polyclonal
- Antigen
- synthetic peptide corresponding to a region of human ANXA5 with an internal ID of P08114
- Description
- IgG fraction of antiserum
- Reactivity
- Human
- Antigen sequence
KVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVV
GDTSGYYQRMLVVLL- Storage
- -20C
Submitted references Comparative analysis of proteome and transcriptome variation in mouse.
Ghazalpour A, Bennett B, Petyuk VA, Orozco L, Hagopian R, Mungrue IN, Farber CR, Sinsheimer J, Kang HM, Furlotte N, Park CC, Wen PZ, Brewer H, Weitz K, Camp DG 2nd, Pan C, Yordanova R, Neuhaus I, Tilford C, Siemers N, Gargalovic P, Eskin E, Kirchgessner T, Smith DJ, Smith RD, Lusis AJ
PLoS genetics 2011 Jun;7(6):e1001393
PLoS genetics 2011 Jun;7(6):e1001393
No comments: Submit comment
No validations: Submit validation data