Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311464 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ropporin, Rhophilin Associated Protein 1B (ROPN1B) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ROPN1B antibody: synthetic peptide directed towards the N terminal of human ROPN1B
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
DYFEALSRGETPPVRERSERVALCNWAELTPELLK
ILHSQ VAGRLIIRAE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of sperm-specific proteins that interact with A-kinase anchoring proteins in a manner similar to the type II regulatory subunit of PKA.
Carr DW, Fujita A, Stentz CL, Liberty GA, Olson GE, Narumiya S
The Journal of biological chemistry 2001 May 18;276(20):17332-8
The Journal of biological chemistry 2001 May 18;276(20):17332-8
No comments: Submit comment
No validations: Submit validation data