Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00064122-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00064122-M01, RRID:AB_1137218
- Product name
- FN3K monoclonal antibody (M01), clone 4F2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FN3K.
- Antigen sequence
ALRSTGLVRVPRPMKVIDLPGGGAAFVMEHLKMKS
LSSQASKLGEQMADLHLYNQKLREKLKEEENTVGR
RGEGAEPQYVDKFGFHTVTCCGFIPQVNEWQDDWP
TFFAR- Isotype
- IgG
- Antibody clone number
- 4F2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- FN3K monoclonal antibody (M01), clone 4F2. Western Blot analysis of FN3K expression in HepG2 ( Cat # L019V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged FN3K is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol