Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051696-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051696-A01, RRID:AB_462890
- Product name
- HECA polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant HECA.
- Antigen sequence
CHLQGRLMHLYAVCVDCLEGVHKIICIKCKSRWDG
SWHQLGTMYTYDILAASPCCQARLNCKHCGKPVID
VRIGMQYFSEYSNVQQCPHCGNLDYHFVKPFSSFK
VLEAY- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The human HECA interacts with cyclins and CDKs to antagonize Wnt-mediated proliferation and chemoresistance of head and neck cancer cells.
The human homolog of the Drosophila headcase protein slows down cell division of head and neck cancer cells.
Dowejko A, Bauer R, Bauer K, Müller-Richter UD, Reichert TE
Experimental cell research 2012 Mar 10;318(5):489-99
Experimental cell research 2012 Mar 10;318(5):489-99
The human homolog of the Drosophila headcase protein slows down cell division of head and neck cancer cells.
Dowejko A, Bauer RJ, Müller-Richter UD, Reichert TE
Carcinogenesis 2009 Oct;30(10):1678-85
Carcinogenesis 2009 Oct;30(10):1678-85
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HECA polyclonal antibody (A01), Lot # URB7060404QCS1. Western Blot analysis of HECA expression in NIH/3T3.
