ABIN183241

antibody from antibodies-online

Targeting: ZBTB44 BTBD15, HSPC063, ZNF851

Western blot (Data presented on provider website)

Antibody Data

Product number

ABIN183241

Provider

antibodies-online

Product name

anti-Zinc Finger and BTB Domain Containing 44 (ZBTB44) antibody

Antibody type

Polyclonal

Antigen

The immunogen for anti-BTBD15 antibody: synthetic peptide directed towards the C terminal of human BTBD15

Reactivity

Human, Mouse, Rat, Bovine, Canine

Host

Rabbit

Antigen sequence

PVDSSLAFPWTFPFGIDRRIQPEKVKQAENTRTLE
LPGPS ETGRRMADYV


Vial size

50 µg

References

Submitted references

Identification and characterization of peripheral T-cell lymphoma-associated SEREX antigens.

Cooper CD, Lawrie CH, Liggins AP, Collins GP, Hatton CS, Pulford K, Banham AH
PloS one 2011;6(8):e23916

---

Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.

Strausberg RL, Feingold EA, Grouse LH, Derge JG, Klausner RD, Collins FS, Wagner L, Shenmen CM, Schuler GD, Altschul SF, Zeeberg B, Buetow KH, Schaefer CF, Bhat NK, Hopkins RF, Jordan H, Moore T, Max SI, Wang J, Hsieh F, Diatchenko L, Marusina K, Farmer AA, Rubin GM, Hong L, Stapleton M, Soares MB, Bonaldo MF, Casavant TL, Scheetz TE, Brownstein MJ, Usdin TB, Toshiyuki S, Carninci P, Prange C, Raha SS, Loquellano NA, Peters GJ, Abramson RD, Mullahy SJ, Bosak SA, McEwan PJ, McKernan KJ, Malek JA, Gunaratne PH, Richards S, Worley KC, Hale S, Garcia AM, Gay LJ, Hulyk SW, Villalon DK, Muzny DM, Sodergren EJ, Lu X, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madan A, Young AC, Shevchenko Y, Bouffard GG, Blakesley RW, Touchman JW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Krzywinski MI, Skalska U, Smailus DE, Schnerch A, Schein JE, Jones SJ, Marra MA, Mammalian Gene Collection Program Team
Proceedings of the National Academy of Sciences of the United States of America 2002 Dec 24;99(26):16899-903