HPA029949

SASH1 antibody from Atlas Antibodies
dJ323M4.1, KIAA0790, SH3D6A

Antibody data

Product number
HPA029949
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA029949, RRID:AB_10602280
Product name
Anti-SASH1
Provider product page
Atlas Antibodies - HPA029949
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KGEDVGYVASEITMSDEERIQLMMMVKEKMITIEE
ALARLKEYEAQHRQSAALDPADWPDGSYPTFDGSS
NCNSREQSDDETE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.