H00023328-M01J

SASH1 antibody from Abnova Corporation
dJ323M4.1, KIAA0790, SH3D6A

Antibody data

Product number
H00023328-M01J
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023328-M01J, RRID:AB_875826
Product name
SASH1 monoclonal antibody (M01J), clone 10B7
Provider product page
Abnova Corporation - H00023328-M01J
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SASH1.
Antigen sequence
ENTSLQEHGVKLGPALTRKVSCARGVDLETLTENK
LHAEGIDLTEEPYSDKHGRCGIPEALVQRYAEDLD
QPERDVAANMDQIRVKQLRKQHRMAIPSGGLTEIC
RKPVS
Isotype
IgG
Antibody clone number
10B7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.