Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023328-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023328-M01, RRID:AB_464410
- Product name
- SASH1 monoclonal antibody (M01), clone 10B7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SASH1.
- Antigen sequence
ENTSLQEHGVKLGPALTRKVSCARGVDLETLTENK
LHAEGIDLTEEPYSDKHGRCGIPEALVQRYAEDLD
QPERDVAANMDQIRVKQLRKQHRMAIPSGGLTEIC
RKPVS- Isotype
- IgG
- Antibody clone number
- 10B7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references SASH1 regulates melanocyte transepithelial migration through a novel Gαs-SASH1-IQGAP1-E-Cadherin dependent pathway.
Zhou D, Wei Z, Deng S, Wang T, Zai M, Wang H, Guo L, Zhang J, Zhong H, He L, Xing Q
Cellular signalling 2013 Jun;25(6):1526-38
Cellular signalling 2013 Jun;25(6):1526-38
No comments: Submit comment
No validations: Submit validation data