Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA021775 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA021775, RRID:AB_1845990
- Product name
- Anti-CA3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWS
VSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGP
LPGPYR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria
Bachmann J, Burté F, Pramana S, Conte I, Brown B, Orimadegun A, Ajetunmobi W, Afolabi N, Akinkunmi F, Omokhodion S, Akinbami F, Shokunbi W, Kampf C, Pawitan Y, Uhlén M, Sodeinde O, Schwenk J, Wahlgren M, Fernandez-Reyes D, Nilsson P, Kim K
PLoS Pathogens 2014 April;10(4)
PLoS Pathogens 2014 April;10(4)
No comments: Submit comment
Supportive validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-CA3 antibody HPA021775 (A) shows similar pattern to independent antibody HPA026700 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human skeletal muscle and skin tissues using Anti-CA3 antibody. Corresponding CA3 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows low expression as expected.
- Sample type
- HUMAN