Explore
Validate
Learn
Western blot
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA026700 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA026700, RRID:AB_1845991
- Product name
- Anti-CA3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
YWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAK
LRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASF
K- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria
Bachmann J, Burté F, Pramana S, Conte I, Brown B, Orimadegun A, Ajetunmobi W, Afolabi N, Akinkunmi F, Omokhodion S, Akinbami F, Shokunbi W, Kampf C, Pawitan Y, Uhlén M, Sodeinde O, Schwenk J, Wahlgren M, Fernandez-Reyes D, Nilsson P, Kim K
PLoS Pathogens 2014 April;10(4)
PLoS Pathogens 2014 April;10(4)
No comments: Submit comment
Supportive validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-CA3 antibody HPA026700 (A) shows similar pattern to independent antibody HPA021775 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and CA3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY417461).
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human skeletal muscle and heart muscle tissues using Anti-CA3 antibody. Corresponding CA3 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human heart muscle shows low expression as expected.
- Sample type
- HUMAN
