H00006578-A01

antibody from Abnova Corporation

Targeting: SLCO2A1 MATR1, OATP2A1, PGT, SLC21A2

Western blot (Supportive data in Antibodypedia)

Antibody Data

Product number

H00006578-A01

Provider

Abnova Corporation

Proper citation

Abnova Corporation Cat#H00006578-A01, RRID:AB_607049

Product name

SLCO2A1 polyclonal antibody (A01)

Antibody type

Polyclonal

Description

Mouse polyclonal antibody raised against a partial recombinant SLCO2A1.

Antigen sequence

FFFPRAMPIGAKRAPATADEARKLEEAKSRGSLVD
FIKRFPCIFLRLLMN


Storage

Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

References

Submitted references

Reduction of prostaglandin transporter predicts poor prognosis associated with angiogenesis in gastric adenocarcinoma.

Takeda S, Tanigawa T, Watanabe T, Tatsuwaki H, Nadatani Y, Otani K, Nagami Y, Tanaka F, Kamata N, Yamagami H, Shiba M, Tominaga K, Fujiwara Y, Muguruma K, Ohira M, Hirakawa K, Arakawa T
Journal of gastroenterology and hepatology 2016 Feb;31(2):376-83

---

The prostaglandin transporter OATP2A1 is expressed in human ocular tissues and transports the antiglaucoma prostanoid latanoprost.

Kraft ME, Glaeser H, Mandery K, König J, Auge D, Fromm MF, Schlötzer-Schrehardt U, Welge-Lüssen U, Kruse FE, Zolk O
Investigative ophthalmology & visual science 2010 May;51(5):2504-11

---

Influence of cyclooxygenase inhibitors on the function of the prostaglandin transporter organic anion-transporting polypeptide 2A1 expressed in human gastroduodenal mucosa.

Mandery K, Bujok K, Schmidt I, Wex T, Treiber G, Malfertheiner P, Rau TT, Amann KU, Brune K, Fromm MF, Glaeser H
The Journal of pharmacology and experimental therapeutics 2010 Feb;332(2):345-51

Western blot

Supportive validation

Submitted by

Abnova Corporation (provider)

Main image

Experimental details

SLCO2A1 polyclonal antibody (A01), Lot # 060529JCS1 Western Blot analysis of SLCO2A1 expression in HL-60 ( Cat # L014V1 ).