Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003625-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003625-A01, RRID:AB_489673
- Product name
- INHBB polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant INHBB.
- Antigen sequence
GRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYC
EGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGT
VNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVE
ECGCA- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Autoantibody response against NALP5/MATER in primary ovarian insufficiency and in autoimmune Addison's disease.
Brozzetti A, Alimohammadi M, Morelli S, Minarelli V, Hallgren Å, Giordano R, De Bellis A, Perniola R, Kämpe O, Falorni A, Italian Addison Network
The Journal of clinical endocrinology and metabolism 2015 May;100(5):1941-8
The Journal of clinical endocrinology and metabolism 2015 May;100(5):1941-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- INHBB polyclonal antibody (A01), Lot # 060125JC01. Western Blot analysis of INHBB expression in human ovarian cancer.