HPA036940

antibody from Atlas Antibodies

Targeting: PCCB

Antibody data

Submit

Validation data

Product number: HPA036940 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA036940, RRID:AB_10669779
Product name: Anti-PCCB
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHE NVEAAQAEYIEKFANPFPAAVRGFVDDIIQPSSTR ARICCDLDVL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PCCB protein structure - HPA036940 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human liver and skin tissues using HPA036940 antibody. Corresponding PCCB RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human kidney, liver, salivary gland and tonsil using Anti-PCCB antibody HPA036940 (A) shows similar protein distribution across tissues to independent antibody HPA036939 (B).
Antibody #2 product nr: HPA036939
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows strong granular cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows only weak cytoplasmic positivity in a subset of epidermal cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil using Anti-PCCB antibody HPA036940.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human salivary gland using Anti-PCCB antibody HPA036940.
Sample type: HUMAN