Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001647-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001647-M01, RRID:AB_437027
- Product name
- GADD45A monoclonal antibody (M01), clone 3D12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GADD45A.
- Antigen sequence
TLIQAFCCENDINILRVSNPGRLAELLLLETDAGP
AASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLIC
FCRESRYMDQWVPVINLPER- Isotype
- IgG
- Antibody clone number
- 3D12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Decitabine-induced demethylation of 5' CpG island in GADD45A leads to apoptosis in osteosarcoma cells.
Al-Romaih K, Sadikovic B, Yoshimoto M, Wang Y, Zielenska M, Squire JA
Neoplasia (New York, N.Y.) 2008 May;10(5):471-80
Neoplasia (New York, N.Y.) 2008 May;10(5):471-80
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between MAP2K6 and GADD45A. HeLa cells were stained with anti-MAP2K6 rabbit purified polyclonal 1:1200 and anti-GADD45A mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)