HPA040000

antibody from Atlas Antibodies

Targeting: NME9 NM23-H9, TXL-2, TXNDC6

Antibody data

Submit

Validation data

Product number: HPA040000 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA040000, RRID:AB_2676793
Product name: Anti-NME9
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: AVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVR LFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGF EDVVTTWRTV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

NME9 protein structure - HPA040000 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human fallopian tube and colon tissues using Anti-NME9 antibody. Corresponding NME9 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, fallopian tube, lymph node and testis using Anti-NME9 antibody HPA040000 (A) shows similar protein distribution across tissues to independent antibody HPA043881 (B).
Antibody #2 product nr: HPA043881
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-NME9 antibody HPA040000.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-NME9 antibody HPA040000.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-NME9 antibody HPA040000.
Sample type: HUMAN