Antibody data

Product number
HPA039077
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA039077, RRID:AB_2676336
Product name
Anti-NMNAT3
Provider product page
Atlas Antibodies - HPA039077
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGK
KDLAASHHRVAMARLALQTSDWIR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -